PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462916582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 1870aa    MW: 208401 Da    PI: 8.9902
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462916582genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.32e-11391191497
                T-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3  14 grlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                ++  +p kf++++  +++ ++ + ++  ++g+++++kl  +  ++ +++t+GW++Fv+ +g+  +D++++++++++ f  ++kvf
  462916582  39 HLQLIPAKFVQQCmPSDHLNNSMAIILGPHGKVYNIKL--EMVRSDTFFTGGWSQFVEFHGITKNDSLLLRYESNMVF--TIKVF 119
                55689*****999944455556788899**********..77777799************************999999..77776 PP

2B347.23.9e-15202279886
                -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                ++ + ++ + lp  f+e++g+ +++++tl+   +s rsW  +l+   ++++++++ GW +F+++ng+++gD+++F+ ++
  462916582 202 HYGMLLSHVNLPHAFCEAIGLRQHCTITLKTSMSSPRSWLARLR-PYNPCSHLIGHGWMNFCHENGIRVGDICTFTIVE 279
                5555566789************88876666666777*******4.678899************************9654 PP

3B332.61.4e-102853631799
                E--HHH.HTT---..--SEEEEEETTS...-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
         B3  17 vlpkkfaeehggkkeesktltledesg...rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                ++p + a+e+g     + +  +  +sg   ++W+v++  r+ +++ vl+ GW eF+ a g  +g f+v+++    ++ l+vk+f++
  462916582 285 RIPDELAAEIGAG---NGEALVIGPSGdevKVWKVEV--RRDGDGAVLGHGWPEFAAACGAGAGWFLVLRHR--GRGVLTVKAFDA 363
                7999999999644...2368899999999********..*******************************65..567779999987 PP

4B340.84.1e-135015682697
                T---..--SEEEEEE.TTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3  26 hggkkeesktltled.esg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                +g+++ +   +tl++ + g rsW++ ++ r++ +++  t+GWk+F+++n+Lk+gD ++F  ++   ++l+++++
  462916582 501 IGLQESCL--ITLKTsLCGvRSWQLAITPRRR-SSHRVTGGWKRFCQDNELKVGDLCTFNIVE---TRLWHRIL 568
                36675554..5555534447*******43333.35999*********************9654...45576665 PP

5B346.56.5e-157718371784
                E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
         B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                 l + f++++g+ + + +tl++   s+ sW+v    +k+s +y+l +GWk+F+k+n++kegD+++F  
  462916582 771 ALARVFCDAIGLRESCMITLKISMDSNASWQVHGLPSKNS-SYMLMRGWKRFCKENRIKEGDICTFNI 837
                68899*****************************444443.5************************85 PP

6B3505.2e-168469131886
                --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3  18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldg 86 
                lp +f+e++g++ ++++tl+   +s rsW  +l  r +  + ++l++GWk+F+ +ng+++gD+++F++++
  462916582 846 LPLTFCEKIGLQRHCTITLKTSMSSTRSWLARL--RPYELSsHLLGSGWKSFCYDNGIRVGDVCTFTVVE 913
                89**********99988888777999*******..7777666*************************654 PP

7B340.64.5e-1399310661185
                 HHTT-EE--HHH.HTT---..--SEEEEEETTS..-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
         B3   11 lksgrlvlpkkfaeehggkkeesktltledesg..rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85  
                  ++++ +lp++f++++g ++++  ++tl+d+    + W+v+  ++ + g++ l++GWk F+++ +L+egD++++ ++
  462916582  993 ISECNKTLPRPFCNAIGFQEPC--MITLQDSMDstKLWQVQG-HTYTTGSCQLGSGWKIFCQDTRLREGDVLTINVI 1066
                 678999**********999777..79999955555******9.566666677********************99865 PP

8B3443.9e-14107411381883
                 --HHH.HTT---..--SEEEEEE.TTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
         B3   18 lpkkfaeehggkkeesktltled.esg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83  
                 lp  f++++g+++++   +tl++ + g rsW v l+ +kk +++  ++GWk+F+k+n+Lk+gD+++F 
  462916582 1074 LPAVFCDAIGLQETCL--VTLKSsLCGaRSWLVCLKPNKK-SSHRVKSGWKRFCKENKLKVGDVCTFN 1138
                 8999********9886..6666633336*******54433.45999*********************8 PP

9B354.32.4e-17140114681785
                 E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
         B3   17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85  
                  l ++f++++g+ k+++++l+    s rsW+v+++ r + ++y+l +GW +F+++n LkegD+++F  +
  462916582 1401 FLARRFCDAIGLLKHCKIMLKTSMDSTRSWQVQCT-RYNNNSYMLHRGWGRFCQENSLKEGDVCTFNII 1468
                 5899*********99976666666777*******4.555567************************865 PP

10B330.85.2e-10147515431786
                 E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86  
                 +lp +f+ ++g+ +++ +tl+   +s+ sW+  + +    + ++ ++ Wk F+++ngLkegD+++F +++
  462916582 1475 SLPLSFCVAIGLREPCIITLKTSMSSSMSWQACV-FPYMYNNHIRGSRWKMFCQENGLKEGDICTFNVIE 1543
                 79***********999877777778889998888.433344578899*******************9765 PP

11B331.72.7e-1015741658997
                 HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3    9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97  
                  ++ ++ + +p kf++++  +++ +s + t+  ++g++ +++l  +  +   +++++W +Fv  ng++egD+++++++g+  f   vk+f
  462916582 1574 KYFMEK-MLIPAKFVQRYlPKEHLSSCMATVLGPRGKVCSIEL--EMDRLDLFFAGCWPQFVALNGIREGDSLLLRYEGNVAF--SVKLF 1658
                 444444.99*********966677899****************..888888**************************998888..77776 PP

12B338.81.6e-12167317391986
                 -HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86  
                    f +++g+ +++++tl+    + +sW v    +kk+ ++++ +GWk+F+++n LkegD ++F +++
  462916582 1673 ATAFSNAIGLWEPCTITLKTSMDNTESWPVHGLPWKKR-SFLIVQGWKRFCQENSLKEGDLCIFNVIK 1739
                 5566666677777766666555777*******888886.788999*******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
PROSITE profilePS5086310.94126122IPR003340B3 DNA binding domain
SMARTSM010191.7E-831122IPR003340B3 DNA binding domain
CDDcd100172.57E-1032119No hitNo description
SuperFamilySSF1019362.94E-1537124IPR015300DNA-binding pseudobarrel domain
PfamPF023624.0E-939118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-1439124IPR015300DNA-binding pseudobarrel domain
CDDcd100171.26E-9195281No hitNo description
PROSITE profilePS5086310.123195298IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.6E-14202281IPR015300DNA-binding pseudobarrel domain
PfamPF023621.7E-11206284IPR003340B3 DNA binding domain
SuperFamilySSF1019361.16E-12208280IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0014272364IPR003340B3 DNA binding domain
PfamPF023622.1E-7285363IPR003340B3 DNA binding domain
SuperFamilySSF1019361.94E-8285364IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.2E-10285365IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.642312364IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.7E-13389487IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.206389485IPR003340B3 DNA binding domain
SuperFamilySSF1019363.92E-15390487IPR015300DNA-binding pseudobarrel domain
CDDcd100171.27E-7390482No hitNo description
SMARTSM010191.0E-6392485IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-11499562IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.51E-9500561IPR015300DNA-binding pseudobarrel domain
CDDcd100171.02E-7501556No hitNo description
PfamPF023622.7E-10502569IPR003340B3 DNA binding domain
SMARTSM010190.82507571IPR003340B3 DNA binding domain
PROSITE profilePS508639.953519572IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.9E-6588643IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-6593643IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.64605643IPR003340B3 DNA binding domain
SMARTSM010190.45668750IPR003340B3 DNA binding domain
SuperFamilySSF1019364.51E-8675747IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-7675748IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.964676753IPR003340B3 DNA binding domain
PROSITE profilePS508638.67755835IPR003340B3 DNA binding domain
SMARTSM010190.0088763854IPR003340B3 DNA binding domain
SuperFamilySSF1019361.82E-12767840IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.4E-13768839IPR015300DNA-binding pseudobarrel domain
PfamPF023623.4E-11772837IPR003340B3 DNA binding domain
CDDcd100177.00E-8776835No hitNo description
SuperFamilySSF1019363.14E-15845921IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-16845921IPR015300DNA-binding pseudobarrel domain
PfamPF023627.2E-12846914IPR003340B3 DNA binding domain
CDDcd100171.23E-9846915No hitNo description
PROSITE profilePS5086311.505846925IPR003340B3 DNA binding domain
SMARTSM010190.058860973IPR003340B3 DNA binding domain
SuperFamilySSF1019361.31E-6922975IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-7922974IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.527936973IPR003340B3 DNA binding domain
PfamPF023627.8E-109921067IPR003340B3 DNA binding domain
CDDcd100177.55E-79931063No hitNo description
SuperFamilySSF1019361.57E-109941070IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.3E-109961071IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.13210001056IPR003340B3 DNA binding domain
PROSITE profilePS5086310.67310571154IPR003340B3 DNA binding domain
SMARTSM010190.02610661148IPR003340B3 DNA binding domain
SuperFamilySSF1019361.41E-1210711139IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-1110731139IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-1310741139IPR015300DNA-binding pseudobarrel domain
CDDcd100171.07E-910741137No hitNo description
CDDcd100174.97E-611211215No hitNo description
Gene3DG3DSA:2.40.330.102.3E-911401219IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-911401219IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.45811631217IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-612311282IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.68312311280IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-712321282IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.3E-613911484IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-1514011471IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-1314011470IPR015300DNA-binding pseudobarrel domain
PfamPF023623.8E-1414021468IPR003340B3 DNA binding domain
CDDcd100172.14E-1114041484No hitNo description
PROSITE profilePS5086311.4214171488IPR003340B3 DNA binding domain
SuperFamilySSF1019361.28E-1114731552IPR015300DNA-binding pseudobarrel domain
PfamPF023628.6E-814751548IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-1014751552IPR015300DNA-binding pseudobarrel domain
CDDcd100174.89E-614751539No hitNo description
PROSITE profilePS508639.02314921555IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-1415641663IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-1515651663IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.68615651661IPR003340B3 DNA binding domain
CDDcd100174.29E-1115661658No hitNo description
SMARTSM010195.0E-515681661IPR003340B3 DNA binding domain
PfamPF023621.3E-815751658IPR003340B3 DNA binding domain
SMARTSM010190.1216721751IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-1216721746IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-1316731750IPR015300DNA-binding pseudobarrel domain
PfamPF023623.0E-916771739IPR003340B3 DNA binding domain
CDDcd100175.76E-716841735No hitNo description
PROSITE profilePS5086310.33416871751IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1870 aa     Download sequence    Send to blast
MCAAPARGGS SSSGTAAAAC SPSRRSTPAA ASASLVLRHL QLIPAKFVQQ CMPSDHLNNS  60
MAIILGPHGK VYNIKLEMVR SDTFFTGGWS QFVEFHGITK NDSLLLRYES NMVFTIKVFG  120
PDGCQKESKH EETRVQESFD NNFLRCNWVA ETSHDNAQDI NGQYCLLAGA RSPMQDRVGR  180
GSARRTISRK ETSALSISSK PHYGMLLSHV NLPHAFCEAI GLRQHCTITL KTSMSSPRSW  240
LARLRPYNPC SHLIGHGWMN FCHENGIRVG DICTFTIVET NLWHRIPDEL AAEIGAGNGE  300
ALVIGPSGDE VKVWKVEVRR DGDGAVLGHG WPEFAAACGA GAGWFLVLRH RGRGVLTVKA  360
FDASGSIREI GAPAPPGAEA TVRSKATFKP QFIRVLPQDF IEKMLIPAKF VQHYILKEHL  420
DKSKAVIFVP LGKIYQIELK MNQSGVFFAG GWPQFLSFHN ITGPNTLLLR YEGNMVFTVK  480
VFEANGCLRV ANHKDIRMQQ IGLQESCLIT LKTSLCGVRS WQLAITPRRR SSHRVTGGWK  540
RFCQDNELKV GDLCTFNIVE TRLWHRILDE LAEDIGAAEA HVEIPFGKGK VRRHVEVGRD  600
GDGAFLGRGW KEFAAACGVG AGWLLVLRHC GGGMLTVKAF DDSGSLRELA AQPPAGKDRI  660
SHANPGPFLE VPGNQIPAAF VQSYIPKEDM NNPMAVVYVP LGKTSHIEFE MNRSDVFFAG  720
GWSKFLSNNS ITAANCLLLR YEGTMCFNPM GSRECRSAVT IYFSKMTKIW ALARVFCDAI  780
GLRESCMITL KISMDSNASW QVHGLPSKNS SYMLMRGWKR FCKENRIKEG DICTFNIVEP  840
TLWNNLPLTF CEKIGLQRHC TITLKTSMSS TRSWLARLRP YELSSHLLGS GWKSFCYDNG  900
IRVGDVCTFT VVETNLWHVT IVWKVDVRRD GAGAVLGRGW PEFAAACGAG AGWFLVLRHR  960
GRGVLTVKTF DASYCLRELG APVPPAGGPN TRISECNKTL PRPFCNAIGF QEPCMITLQD  1020
SMDSTKLWQV QGHTYTTGSC QLGSGWKIFC QDTRLREGDV LTINVIKTTL WHALPAVFCD  1080
AIGLQETCLV TLKSSLCGAR SWLVCLKPNK KSSHRVKSGW KRFCKENKLK VGDVCTFNIV  1140
RIPDELAEDI GAAEAHVVIP LGKGKVRRVE VGRDGDGAFL GRGWPEFADA CGVGAGWLLV  1200
LRHHGAGVLT VKVFDDTGCL QMQAREPPAV QIELEMNRSG MFFAAGWSQF LAFHGISEAN  1260
CLLLRYEGNM MFTVKVFEPE GCQRDSTHNC TGMQQISTLP VSEKKNVKPS ASVEMSKNDW  1320
LSSGQKKQKA FTSSLKKTSL QKRSSYEIGP SSWIKKVISA GALENHLVST TISLLVIFVR  1380
SDKWWVIGHK LKLVTLQLLQ FLARRFCDAI GLLKHCKIML KTSMDSTRSW QVQCTRYNNN  1440
SYMLHRGWGR FCQENSLKEG DVCTFNIIET ALWHSLPLSF CVAIGLREPC IITLKTSMSS  1500
SMSWQACVFP YMYNNHIRGS RWKMFCQENG LKEGDICTFN VIETTLWHVI IVPDKTRSSK  1560
GAIRKPQFIR VLSKYFMEKM LIPAKFVQRY LPKEHLSSCM ATVLGPRGKV CSIELEMDRL  1620
DLFFAGCWPQ FVALNGIREG DSLLLRYEGN VAFSVKLFGP DGCRRECELR ALATAFSNAI  1680
GLWEPCTITL KTSMDNTESW PVHGLPWKKR SFLIVQGWKR FCQENSLKEG DLCIFNVIKT  1740
TLMNINKIQK QQETPPASKY DCSDNEGGKR PKGSMTVRNK ASSQKNGIFD IGPPAWIQKE  1800
MSSSTIKNRL YLSPIFCEAI GIREACSHAQ DVNDQHQVLA GACSPVRLLQ PPYCWAGLDE  1860
LLPREQDQGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3YDR84e-96K3YDR8_SETIT; Uncharacterized protein
STRINGSi012375m1e-95(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.14e-11B3 family protein